Product Number |
ARP46852_P050 |
Product Page |
www.avivasysbio.com/bace2-antibody-middle-region-arp46852-p050.html |
Name |
BACE2 Antibody - middle region (ARP46852_P050) |
Protein Size (# AA) |
396 amino acids |
Molecular Weight |
37kDa |
NCBI Gene Id |
25825 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Beta-site APP-cleaving enzyme 2 |
Alias Symbols |
ASP1, BAE2, DRAP, AEPLC, ALP56, ASP21, CDA13, CEAP1 |
Peptide Sequence |
Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene. |
Protein Interactions |
UBC; BACE2; APP; GGA1; GGA2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-BACE2 (ARP46852_P050) antibody |
Blocking Peptide |
For anti-BACE2 (ARP46852_P050) antibody is Catalog # AAP46852 (Previous Catalog # AAPP27648) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human BACE2 |
Uniprot ID |
Q9Y5Z0 |
Protein Name |
Beta-secretase 2 |
Sample Type Confirmation |
BACE2 is supported by BioGPS gene expression data to be expressed in ACHN |
Protein Accession # |
NP_620477 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_138992 |
Tested Species Reactivity |
Human |
Gene Symbol |
BACE2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 92% |
Image 1 | Human ACHN
| WB Suggested Anti-BACE2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: ACHN cell lysateBACE2 is supported by BioGPS gene expression data to be expressed in ACHN |
|