MMP16 Antibody - N-terminal region (ARP46674_P050)

• Product Number: ARP46674_P050
• Name: MMP16 Antibody - N-terminal region (ARP46674_P050)
• Protein Size (# AA): 607 amino acids
• Molecular Weight: 56kDa
• NCBI Gene Id: 4325
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Matrix metallopeptidase 16 (membrane-inserted)
• Alias Symbols: MMP-X2, C8orf57, MT-MMP2, MT-MMP3, MT3-MMP
• Peptide Sequence: Synthetic peptide located within the following region: ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Iida,J., (2007) Biochem. J. 403 (3), 553-563
• Description of Target: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another soluble form of the protein. Both forms of the protein activate MMP2 by cleavage.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another a soluble form of the protein. Both forms of the protein activate MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.
• Protein Interactions: KISS1; LRP1; ERBB2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MMP16 (ARP46674_P050) antibody is Catalog # AAP46674 (Previous Catalog # AAPS21605)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMP16
• Uniprot ID: P51512
• Protein Name: Matrix metalloproteinase-16
• Protein Accession #: NP_005932
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005941
• Tested Species Reactivity: Human
• Gene Symbol: MMP16
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human MCF-7
  
  WB Suggested Anti-MMP16 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: MCF7 cell lysate