RARRES3 Antibody - middle region (ARP46474_T100)

Data Sheet
 
Product Number ARP46474_T100
Product Page www.avivasysbio.com/rarres3-antibody-middle-region-arp46474-t100.html
Name RARRES3 Antibody - middle region (ARP46474_T100)
Protein Size (# AA) 164 amino acids
Molecular Weight 18kDa
NCBI Gene Id 5920
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Retinoic acid receptor responder (tazarotene induced) 3
Alias Symbols RIG1, TIG3, HRSL4, HRASLS4, PLAAT-4, RARRES3, PLA1/2-3
Peptide Sequence Synthetic peptide located within the following region: FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lotz,K., (2005) Int. J. Cancer 116 (6), 894-902
Description of Target Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES3 is thought act as a tumor suppressor or growth regulator.Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator.
Protein Interactions SGTA; PTGDS; MAVS; UBC; TRAT1; YWHAE; SUMO1; UBE2I; HSP90AA1; TNFAIP3; TGM1; HRAS; RNF135; TRIM25;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RARRES3 (ARP46474_T100) antibody
Additional Information IHC Information: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 15%.
Blocking Peptide For anti-RARRES3 (ARP46474_T100) antibody is Catalog # AAP46474 (Previous Catalog # AAPS18604)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RARRES3
Uniprot ID Q9UL19
Protein Name Retinoic acid receptor responder protein 3
Protein Accession # NP_004576
Purification Protein A purified
Nucleotide Accession # NM_004585
Tested Species Reactivity Human
Gene Symbol RARRES3
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 93%
Image 1
Human Stomach
Human Stomach
Image 2
Human HepG2
WB Suggested Anti-RARRES3 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com