| Product Number |
ARP46462_P050 |
| Product Page |
www.avivasysbio.com/galnt3-antibody-n-terminal-region-arp46462-p050.html |
| Name |
Galnt3 Antibody - N-terminal region (ARP46462_P050) |
| Protein Size (# AA) |
633 amino acids |
| Molecular Weight |
73kDa |
| NCBI Gene Id |
366061 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3) |
| Alias Symbols |
MGC124508, Galnt3 |
| Peptide Sequence |
Synthetic peptide located within the following region: PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Galnt3 (ARP46462_P050) antibody |
| Blocking Peptide |
For anti-Galnt3 (ARP46462_P050) antibody is Catalog # AAP46462 (Previous Catalog # AAPS18504) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
Q3T1J4 |
| Protein Name |
Protein Galnt3 Ensembl ENSRNOP00000007615 |
| Protein Accession # |
NP_001015032 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001015032 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Galnt3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Rat Brain
 | WB Suggested Anti-Galnt3 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Brain |
|
|
