website statistics
Product Datasheet: ARP46436_T100 - CLGN antibody - N-terminal region (ARP46436_T100) - Aviva Systems Biology
CLGN antibody - N-terminal region (ARP46436_T100)
Data Sheet
Product Number ARP46436_T100
Product Page
Product Name CLGN antibody - N-terminal region (ARP46436_T100)
Size 100 ul
Gene Symbol CLGN
Alias Symbols -
Protein Size (# AA) 610 amino acids
Molecular Weight 70kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1047
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Calmegin
Description This is a rabbit polyclonal antibody against CLGN. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL
Target Reference Kim,D.H., (2005) Exp. Mol. Med. 37 (5), 492-496
Description of Target Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneisis and infertility.Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneisis and infertility.
Protein Interactions PCSK9; FBXL4; ADRB2; CLN5; env; GDE1; XK; UBC; TLR9; SARM1; ADAM2; ADAM1A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-CLGN (ARP46436_T100) antibody is Catalog # AAP46436 (Previous Catalog # AAPS18302)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CLGN
Complete computational species homology data Anti-CLGN (ARP46436_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CLGN.
Swissprot Id O14967
Protein Name Calmegin
Protein Accession # NP_004353
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CLGN.
Nucleotide Accession # NM_004362
Conjugation Options

ARP46436_T100-FITC Conjugated

ARP46436_T100-HRP Conjugated

ARP46436_T100-Biotin Conjugated

Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-CLGN Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |