SEMA4F Antibody - N-terminal region (ARP46421_P050)

• Product Number: ARP46421_P050
• Name: SEMA4F Antibody - N-terminal region (ARP46421_P050)
• Protein Size (# AA): 615 amino acids
• Molecular Weight: 67kDa
• NCBI Gene Id: 10505
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
• Alias Symbols: S4F, SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M
• Peptide Sequence: Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
• Protein Interactions: DLG4; NRP2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SEMA4F (ARP46421_P050) antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
• Uniprot ID: O95754-2
• Protein Name: Semaphorin-4F
• Protein Accession #: AAH18361
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004263
• Tested Species Reactivity: Human
• Gene Symbol: SEMA4F
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: human A431
  
  human cell line A431
  Primary antibody dilution and incubation time:1:600, 4 degree overnightSecondary antibody used and dilution and incubation time: 1:3000, RT 2 hours
• Image 2: Human MIA-PACA2
  
  Lanes:
  1. Untransfected MIA-PACA2 cell lysate
  2. Untransfected MIA-PACA2 cell lysate
  3. Untransfected MIA-PACA2 cell lysate
  4. hSEMA4F transfected MIA-PACA2 cell lysate
  5. Untransfected MIA-PACA2 cell lysate
  6. hSEMA4F transfected MIA-PACA2 cell lysate
  Primary Antibody Dilution:
  1:600
  Secondary Antibody:
  Donkey Anti-rabbit HRP
  Secondary Antibody Dilution:
  1:3000
  Gene Name:
  SEMA4F
  Submitted by:
  Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
  
• Image 3: Human A431
  
  Lanes:
  1. A431 cell lysate + control siRNA 2. A431 cell lysate + SEMA4F siRNA
  Primary Antibody Dilution:
  1:600
  Secondary Antibody:
  Donkey Anti-rabbit HRP
  Secondary Antibody Dilution:
  1:3000
  Gene Name:
  SEMA4F
  Submitted by:
  Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
  
• Image 4: Transfected 293T
  
  WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Transfected 293T