| Product Number |
ARP46418_T100 |
| Product Page |
www.avivasysbio.com/tmprss11d-antibody-n-terminal-region-arp46418-t100.html |
| Name |
TMPRSS11D Antibody - N-terminal region (ARP46418_T100) |
| Protein Size (# AA) |
418 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
9407 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transmembrane protease, serine 11D |
| Alias Symbols |
ASP, HAT |
| Peptide Sequence |
Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Matsushima,R., Am. J. Physiol. Lung Cell Mol. Physiol. 290 (2), L385-L395 (2006) |
| Description of Target |
TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TMPRSS11D (ARP46418_T100) antibody |
| Additional Information |
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-TMPRSS11D (ARP46418_T100) antibody is Catalog # AAP46418 (Previous Catalog # AAPS18108) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TMPRSS11D |
| Uniprot ID |
O60235 |
| Protein Name |
Transmembrane protease serine 11D |
| Protein Accession # |
NP_004253 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004262 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TMPRSS11D |
| Predicted Species Reactivity |
Human, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 79%; Horse: 79%; Human: 100%; Rabbit: 79% |
| Image 1 | Human HepG2
 | WB Suggested Antibody Titration: 2.5 ug/ml
Positive Control: HepG2 |
| | Image 2 | Human Lung
 | Human Lung |
|
|
