Product Number |
ARP46395_P050 |
Product Page |
www.avivasysbio.com/osmr-antibody-n-terminal-region-arp46395-p050.html |
Name |
OSMR Antibody - N-terminal region (ARP46395_P050) |
Protein Size (# AA) |
979 amino acids |
Molecular Weight |
111 kDa |
Subunit |
beta |
NCBI Gene Id |
9180 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Oncostatin M receptor |
Alias Symbols |
OSMRB, PLCA1, IL-31RB, OSMRbeta, IL-31R-beta |
Peptide Sequence |
Synthetic peptide located within the following region: YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Arita,K., (2008) Am. J. Hum. Genet. 82 (1), 73-80 |
Description of Target |
Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF.Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
UBC; CUL5; GAPDH; IL6ST; OSM; JAK2; JAK1; ERBB2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-OSMR (ARP46395_P050) antibody |
Blocking Peptide |
For anti-OSMR (ARP46395_P050) antibody is Catalog # AAP46395 (Previous Catalog # AAPP27179) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human OSMR |
Uniprot ID |
Q99650 |
Protein Name |
Oncostatin-M-specific receptor subunit beta |
Sample Type Confirmation |
OSMR is supported by BioGPS gene expression data to be expressed in HT1080 |
Protein Accession # |
NP_003990 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003999 |
Tested Species Reactivity |
Human |
Gene Symbol |
OSMR |
Predicted Species Reactivity |
Human, Cow, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 79%; Human: 100% |
Image 1 | Human HT1080
| WB Suggested Anti-OSMR Antibody Titration: 0.2-1 ug/ml Positive Control: HT1080 cell lysateOSMR is supported by BioGPS gene expression data to be expressed in HT1080 |
|
|