OSMR Antibody - N-terminal region (ARP46395_P050)

Data Sheet
 
Product Number ARP46395_P050
Product Page www.avivasysbio.com/osmr-antibody-n-terminal-region-arp46395-p050.html
Name OSMR Antibody - N-terminal region (ARP46395_P050)
Protein Size (# AA) 979 amino acids
Molecular Weight 111 kDa
Subunit beta
NCBI Gene Id 9180
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Oncostatin M receptor
Alias Symbols OSMRB, PLCA1, IL-31RB, OSMRbeta, IL-31R-beta
Peptide Sequence Synthetic peptide located within the following region: YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Arita,K., (2008) Am. J. Hum. Genet. 82 (1), 73-80
Description of Target Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF.Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions UBC; CUL5; GAPDH; IL6ST; OSM; JAK2; JAK1; ERBB2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-OSMR (ARP46395_P050) antibody
Blocking Peptide For anti-OSMR (ARP46395_P050) antibody is Catalog # AAP46395 (Previous Catalog # AAPP27179)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human OSMR
Uniprot ID Q99650
Protein Name Oncostatin-M-specific receptor subunit beta
Sample Type Confirmation

OSMR is supported by BioGPS gene expression data to be expressed in HT1080

Protein Accession # NP_003990
Purification Affinity Purified
Nucleotide Accession # NM_003999
Tested Species Reactivity Human
Gene Symbol OSMR
Predicted Species Reactivity Human, Cow, Dog
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 79%; Human: 100%
Image 1
Human HT1080
WB Suggested Anti-OSMR Antibody Titration: 0.2-1 ug/ml
Positive Control: HT1080 cell lysateOSMR is supported by BioGPS gene expression data to be expressed in HT1080
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com