GRPEL1 Antibody - N-terminal region (ARP46346_P050)

Data Sheet
 
Product Number ARP46346_P050
Product Page www.avivasysbio.com/grpel1-antibody-n-terminal-region-arp46346-p050.html
Name GRPEL1 Antibody - N-terminal region (ARP46346_P050)
Protein Size (# AA) 217 amino acids
Molecular Weight 24kDa
NCBI Gene Id 80273
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name GrpE-like 1, mitochondrial (E. coli)
Alias Symbols GrpE, HMGE, mt-GrpE#1
Peptide Sequence Synthetic peptide located within the following region: NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target GRPEL1 is essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL1 seems to control the nucleotide-depe
Protein Interactions UBC; RPRD1B; ANP32B; ACTR2; ARPC4; FUBP1; RPA3; RPA1; BAG1; NIF3L1; IFIT1; ATF2; GRPEL1; EBNA-LP; ICT1; TERF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GRPEL1 (ARP46346_P050) antibody
Blocking Peptide For anti-GRPEL1 (ARP46346_P050) antibody is Catalog # AAP46346 (Previous Catalog # AAPP27132)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GRPEL1
Uniprot ID Q9HAV7
Protein Name GrpE protein homolog 1, mitochondrial
Protein Accession # NP_079472
Purification Affinity Purified
Nucleotide Accession # NM_025196
Tested Species Reactivity Human
Gene Symbol GRPEL1
Predicted Species Reactivity Human, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 75%; Human: 100%
Image 1
Human Small Intestine
WB Suggested Anti-GRPEL1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com