| Product Number |
ARP46307_T100 |
| Product Page |
www.avivasysbio.com/ppcdc-antibody-n-terminal-region-arp46307-t100.html |
| Name |
PPCDC Antibody - N-terminal region (ARP46307_T100) |
| Protein Size (# AA) |
204 amino acids |
| Molecular Weight |
22kDa |
| NCBI Gene Id |
60490 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Phosphopantothenoylcysteine decarboxylase |
| Alias Symbols |
coaC, MDS018, PPC-DC |
| Peptide Sequence |
Synthetic peptide located within the following region: VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Daugherty,M., (2002) J. Biol. Chem. 277 (24), 21431-21439 |
| Description of Target |
Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC, one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine. |
| Protein Interactions |
TXN2; PPIG; ZNF232; SREK1IP1; FOXR1; PPCDC; WDYHV1; UBC; DBI; CENPT; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PPCDC (ARP46307_T100) antibody |
| Blocking Peptide |
For anti-PPCDC (ARP46307_T100) antibody is Catalog # AAP46307 (Previous Catalog # AAPS17905) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PPCDC |
| Uniprot ID |
Q96CD2 |
| Protein Name |
Phosphopantothenoylcysteine decarboxylase |
| Protein Accession # |
NP_068595 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021823 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PPCDC |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PPCDC Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
|
