| Product Number |
ARP46298_T100 |
| Product Page |
www.avivasysbio.com/gins1-antibody-n-terminal-region-arp46298-t100.html |
| Name |
GINS1 Antibody - N-terminal region (ARP46298_T100) |
| Protein Size (# AA) |
196 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
9837 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
GINS complex subunit 1 (Psf1 homolog) |
| Alias Symbols |
PSF1, IMD55 |
| Peptide Sequence |
Synthetic peptide located within the following region: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ueno,M., (2005) Mol. Cell. Biol. 25 (23), 10528-10532 |
| Description of Target |
The GINS complex plays an essential role in the initiation of DNA replication. |
| Protein Interactions |
UBC; MRE11A; GINS2; GINS4; GINS3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GINS1 (ARP46298_T100) antibody |
| Blocking Peptide |
For anti-GINS1 (ARP46298_T100) antibody is Catalog # AAP46298 (Previous Catalog # AAPS17808) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GINS1 |
| Uniprot ID |
Q14691 |
| Protein Name |
DNA replication complex GINS protein PSF1 |
| Sample Type Confirmation |
GINS1 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_066545 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021067 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GINS1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-GINS1 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysateGINS1 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
