Product Number |
ARP46166_T100 |
Product Page |
www.avivasysbio.com/ifi44l-antibody-n-terminal-region-arp46166-t100.html |
Name |
IFI44L Antibody - N-terminal region (ARP46166_T100) |
Protein Size (# AA) |
413 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
10964 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Interferon-induced protein 44-like |
Alias Symbols |
GS3686, C1orf29 |
Peptide Sequence |
Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Suzuki,Y., Gene 200 (1-2), 149-156 (1997) |
Description of Target |
The function remains known. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-IFI44L (ARP46166_T100) antibody |
Additional Information |
IHC Information: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%. |
Blocking Peptide |
For anti-IFI44L (ARP46166_T100) antibody is Catalog # AAP46166 (Previous Catalog # AAPP27004) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human IFI44L |
Uniprot ID |
Q99984 |
Protein Name |
Interferon-induced protein 44-like |
Protein Accession # |
NP_006811 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006820 |
Tested Species Reactivity |
Human |
Gene Symbol |
IFI44L |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human Jurkat
| WB Suggested Anti-IFI44L Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysate |
|
|