| Product Number |
ARP46166_T100 |
| Product Page |
www.avivasysbio.com/ifi44l-antibody-n-terminal-region-arp46166-t100.html |
| Name |
IFI44L Antibody - N-terminal region (ARP46166_T100) |
| Protein Size (# AA) |
413 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
10964 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Interferon-induced protein 44-like |
| Alias Symbols |
GS3686, C1orf29 |
| Peptide Sequence |
Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Suzuki,Y., Gene 200 (1-2), 149-156 (1997) |
| Description of Target |
The function remains known. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IFI44L (ARP46166_T100) antibody |
| Additional Information |
IHC Information: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-IFI44L (ARP46166_T100) antibody is Catalog # AAP46166 (Previous Catalog # AAPP27004) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human IFI44L |
| Uniprot ID |
Q99984 |
| Protein Name |
Interferon-induced protein 44-like |
| Protein Accession # |
NP_006811 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_006820 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IFI44L |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human Jurkat
 | WB Suggested Anti-IFI44L Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate |
|
|
