STIP1 Antibody - C-terminal region (ARP46165_T100)

Data Sheet
 
Product Number ARP46165_T100
Product Page www.avivasysbio.com/stip1-antibody-c-terminal-region-arp46165-t100.html
Name STIP1 Antibody - C-terminal region (ARP46165_T100)
Protein Size (# AA) 543 amino acids
Molecular Weight 63 kDa
NCBI Gene Id 10963
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Stress-induced-phosphoprotein 1
Alias Symbols HOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521
Peptide Sequence Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bruneel,A., (2005) Proteomics 5 (15), 3876-3884
Description of Target STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
Protein Interactions HSP90AA1; UBC; MLF2; CCDC117; CDC37L1; HSP90AB1; DNAJB6; BAG2; MDM2; rev; COPS4; CDK9; CDK5; CDK3; PGR; HSPA8; HSPA4; SLC12A3; PWP2; PPP5C; NOS2; LMO2; ITGA4; FN1; ATF2; MAP3K8; METTL21B; KCNQ4; VCAM1; KCNH2; Htt; AHCYL1; SSSCA1; PSMC6; PSMC3; NASP; STMN1
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-STIP1 (ARP46165_T100) antibody
Blocking Peptide For anti-STIP1 (ARP46165_T100) antibody is Catalog # AAP46165 (Previous Catalog # AAPP27102)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human STIP1
Uniprot ID P31948
Protein Name Stress-induced-phosphoprotein 1
Sample Type Confirmation

STIP1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_006810
Purification Protein A purified
Nucleotide Accession # NM_006819
Tested Species Reactivity Human
Gene Symbol STIP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
Image 1
Human Muscle
Human Muscle
Image 2
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com