Bcat1 Antibody - C-terminal region (ARP46133_P050)

Data Sheet
 
Product Number ARP46133_P050
Product Page www.avivasysbio.com/bcat1-antibody-c-terminal-region-arp46133-p050.html
Name Bcat1 Antibody - C-terminal region (ARP46133_P050)
Protein Size (# AA) 453 amino acids
Molecular Weight 43 kDa
NCBI Gene Id 12035
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Branched chain aminotransferase 1, cytosolic
Alias Symbols BCAT, Eca3, BCATc, Bcat-, Eca39
Peptide Sequence Synthetic peptide located within the following region: ACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of Bcat1 remains unknown.
Protein Interactions Myc;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-Bcat1 (ARP46133_P050) antibody
Blocking Peptide For anti-Bcat1 (ARP46133_P050) antibody is Catalog # AAP46133 (Previous Catalog # AAPP26995)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q8CBC8
Protein Name Branched-chain-amino-acid aminotransferase
Protein Accession # NP_001019639
Purification Affinity Purified
Nucleotide Accession # NM_001024468
Tested Species Reactivity Mouse
Gene Symbol Bcat1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 82%; Sheep: 93%
Image 1
Mouse Heart
WB Suggested Anti-Bcat1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com