Product Number |
ARP46133_P050 |
Product Page |
www.avivasysbio.com/bcat1-antibody-c-terminal-region-arp46133-p050.html |
Name |
Bcat1 Antibody - C-terminal region (ARP46133_P050) |
Protein Size (# AA) |
453 amino acids |
Molecular Weight |
43 kDa |
NCBI Gene Id |
12035 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Branched chain aminotransferase 1, cytosolic |
Alias Symbols |
BCAT, Eca3, BCATc, Bcat-, Eca39 |
Peptide Sequence |
Synthetic peptide located within the following region: ACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of Bcat1 remains unknown. |
Protein Interactions |
Myc; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-Bcat1 (ARP46133_P050) antibody |
Blocking Peptide |
For anti-Bcat1 (ARP46133_P050) antibody is Catalog # AAP46133 (Previous Catalog # AAPP26995) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q8CBC8 |
Protein Name |
Branched-chain-amino-acid aminotransferase |
Protein Accession # |
NP_001019639 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001024468 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Bcat1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 82%; Sheep: 93% |
Image 1 | Mouse Heart
| WB Suggested Anti-Bcat1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Mouse Heart |
|
|