MMP7 Antibody - C-terminal region (ARP46075_T100)

• Product Number: ARP46075_T100
• Name: MMP7 Antibody - C-terminal region (ARP46075_T100)
• Protein Size (# AA): 267 amino acids
• Molecular Weight: 19kDa
• NCBI Gene Id: 4316
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Matrix metallopeptidase 7 (matrilysin, uterine)
• Alias Symbols: MMP-7, MPSL1, PUMP-1
• Peptide Sequence: Synthetic peptide located within the following region: AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Holnthoner,W., (2006) Biochem. Biophys. Res. Commun. 342 (3), 725-733
• Description of Target: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP7 degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
• Protein Interactions: NGF; TNFSF11; CD151; BCAN; SERPINA1; PLG; SPP1; MBP; TFPI; FASLG; HBEGF; DCN; MMP9; MMP1; HAPLN1; CD44; ZBTB33;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MMP7 (ARP46075_T100) antibody is Catalog # AAP46075 (Previous Catalog # AAPS17309)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MMP7
• Uniprot ID: P09237
• Protein Name: Matrilysin
• Protein Accession #: NP_002414
• Purification: Protein A purified
• Nucleotide Accession #: NM_002423
• Tested Species Reactivity: Human
• Gene Symbol: MMP7
• Predicted Species Reactivity: Human, Cow, Guinea Pig, Horse, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 83%; Guinea Pig: 75%; Horse: 79%; Human: 100%; Rabbit: 83%; Sheep: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-MMP7 Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysate