CTH Antibody - C-terminal region (ARP46068_T100)

• Product Number: ARP46068_T100
• Name: CTH Antibody - C-terminal region (ARP46068_T100)
• Protein Size (# AA): 405 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 1491
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Cystathionase (cystathionine gamma-lyase)
• Alias Symbols: MGC9471
• Peptide Sequence: Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Yang,G., (2004) J. Biol. Chem. 279 (47), 49199-49205
• Description of Target: CTH is a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in its gene cause cystathioninuria.This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
• Protein Interactions: GUCD1; WDYHV1; RECK; CTH; PTMA; GMDS; CAPN2; ATIC; SDCBP2; UBC; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CTH (ARP46068_T100) antibody is Catalog # AAP46068 (Previous Catalog # AAPS17302)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CTH
• Uniprot ID: P32929
• Protein Name: Cystathionine gamma-lyase
• Publications:

  Anti-CTH ARP46068_T100 has recently been referenced in the following publications:

  Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567–73 (2013). 23063804

• Protein Accession #: NP_001893
• Purification: Protein A purified
• Nucleotide Accession #: NM_001902
• Tested Species Reactivity: Human
• Gene Symbol: CTH
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 93%
• Image 1: Human Heart
  
  Human Heart
• Image 2: Human HepG2
  
  WB Suggested Anti-CTH Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysate