Product Number |
ARP46038_T100 |
Product Page |
www.avivasysbio.com/mthfd2-antibody-n-terminal-region-arp46038-t100.html |
Name |
MTHFD2 Antibody - N-terminal region (ARP46038_T100) |
Protein Size (# AA) |
350 amino acids |
Molecular Weight |
27 kDa, 38 kDa |
NCBI Gene Id |
10797 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase |
Alias Symbols |
NMDMC |
Peptide Sequence |
Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
Description of Target |
MTHFD2 is a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD.This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in multiple transcripts encoding different isoforms. This gene has a pseudogene on chromosome 7. |
Protein Interactions |
NAGK; HUWE1; UBC; MDM2; nef; DHX40; GCC1; DHX29; CUL3; ELAVL1; MINOS1; PARP3; PSMD13; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-MTHFD2 (ARP46038_T100) antibody |
Blocking Peptide |
For anti-MTHFD2 (ARP46038_T100) antibody is Catalog # AAP46038 (Previous Catalog # AAPS17001) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFD2 |
Uniprot ID |
P13995 |
Protein Name |
Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial |
Protein Accession # |
NP_006627 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006636 |
Tested Species Reactivity |
Human |
Gene Symbol |
MTHFD2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 86% |
Image 1 | Human HepG2
| WB Suggested Anti-MTHFD2 Antibody Titration: 1.25ug/ml Positive Control: HepG2 cell lysate |
|
Image 2 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Isoforms 1 (38 kDa) and Isoform 2 (27 kDa) can be recognized with this antibody. |
|