MTHFD2 Antibody - N-terminal region (ARP46038_T100)

Data Sheet
 
Product Number ARP46038_T100
Product Page www.avivasysbio.com/mthfd2-antibody-n-terminal-region-arp46038-t100.html
Name MTHFD2 Antibody - N-terminal region (ARP46038_T100)
Protein Size (# AA) 350 amino acids
Molecular Weight 27 kDa, 38 kDa
NCBI Gene Id 10797
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase
Alias Symbols NMDMC
Peptide Sequence Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target MTHFD2 is a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD.This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in multiple transcripts encoding different isoforms. This gene has a pseudogene on chromosome 7.
Protein Interactions NAGK; HUWE1; UBC; MDM2; nef; DHX40; GCC1; DHX29; CUL3; ELAVL1; MINOS1; PARP3; PSMD13;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-MTHFD2 (ARP46038_T100) antibody
Blocking Peptide For anti-MTHFD2 (ARP46038_T100) antibody is Catalog # AAP46038 (Previous Catalog # AAPS17001)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFD2
Uniprot ID P13995
Protein Name Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
Protein Accession # NP_006627
Purification Protein A purified
Nucleotide Accession # NM_006636
Tested Species Reactivity Human
Gene Symbol MTHFD2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 86%
Image 1
Human HepG2
WB Suggested Anti-MTHFD2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Image 2
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Isoforms 1 (38 kDa) and Isoform 2 (27 kDa) can be recognized with this antibody.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com