| Product Number |
ARP46027_T100 |
| Product Page |
http://www.avivasysbio.com/dut-antibody-c-terminal-region-arp46027-t100.html |
| Product Name |
DUT antibody - C-terminal region (ARP46027_T100) |
| Size |
100ug |
| Gene Symbol |
DUT |
| Alias Symbols |
FLJ20622; dUTPase |
| Nucleotide Accession# |
NM_001025248 |
| Protein Accession# |
NP_001020419 |
| Swissprot Id |
P33316 |
| Protein Size (# AA) |
252 amino acids |
| Molecular Weight |
19kDa |
| Product Format |
Lyophilized powder |
| NCBI Gene Id |
1854 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Purification |
Protein A purified |
| Official Gene Full Name |
Deoxyuridine triphosphatase |
| Description |
This is a rabbit polyclonal antibody against DUT. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
| Key Reference |
Studebaker,A.W., (2005) Biochem. Biophys. Res. Commun. 327 (1), 306-310 |
| Description of Target |
DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. |
| Partner Proteins |
CDK1, DUT, ESR1, ESRRA, ESRRG, NUDT18, PPARA, PPARD, SPATA2, NUDT18, SPATA2 |
| Reconstitution and Storage |
Add 100 μl of distilled water. Final anti-DUT antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Additional Information |
IHC Information: Jurkat cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 15%. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-DUT antibody is Catalog # AAP46027 (Previous Catalog # AAPP26870) |
| Immunogen |
The immunogen for anti-DUT antibody: synthetic peptide directed towards the C terminal of human DUT |
| Complete computational species homology data |
DUT antibody - C-terminal region (ARP46027_T100) |
| Tissue Tool |
Find tissues and cell lines supported to express DUT.  |
| Reviews and Data |
Computational species homology for DUT antibody (ARP46027); Product Protocols: DUT antibody tested by IHC with human heart (ARP46027) |
| Homology Short |
Dog, Guinea pig, Horse, Human, Mouse, Rat, Bovine, Chicken, Rabbit, Yeast, Zebrafish, African clawed frog |
| Observed Species Reactivity |
Human, Mouse, Rat, Dog |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Chicken: 92%; Rabbit: 92%; Yeast: 85%; Zebrafish: 85%; African clawed frog: 78% |
| Image 1 | Human Heart
 | |
|
| Image 2 | Human Jurkat
 | WB Suggested Antibody Titration: 2.5ug/ml
Positive Control: Jurkat |
|
