| Product Number |
ARP46017_P050 |
| Product Page |
www.avivasysbio.com/parvb-antibody-n-terminal-region-arp46017-p050.html |
| Name |
PARVB Antibody - N-terminal region (ARP46017_P050) |
| Protein Size (# AA) |
397 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
29780 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Parvin, beta |
| Alias Symbols |
CGI-56 |
| Peptide Sequence |
Synthetic peptide located within the following region: LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Johnstone,C.N., (2008) Mol. Cell. Biol. 28 (2), 687-704 |
| Description of Target |
Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.[supplied by OMIM]. |
| Protein Interactions |
ILK; PSME1; UBC; ARHGEF6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PARVB (ARP46017_P050) antibody |
| Blocking Peptide |
For anti-PARVB (ARP46017_P050) antibody is Catalog # AAP46017 (Previous Catalog # AAPP26860) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PARVB |
| Uniprot ID |
Q96PN1 |
| Protein Name |
Beta-parvin |
| Protein Accession # |
NP_001003828 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001003828 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PARVB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-PARVB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T |
| | Image 2 | Hela, HepG2
 | Host: Rabbit
Target: PARVB
Positive control (+): Hela (HL)
Negative control (-): HepG2 (HG)
Antibody concentration: 1ug/ml |
|
|
