| Product Number |
ARP46013_T100 |
| Product Page |
www.avivasysbio.com/prim1-antibody-n-terminal-region-arp46013-t100.html |
| Name |
PRIM1 Antibody - N-terminal region (ARP46013_T100) |
| Protein Size (# AA) |
420 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
5557 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Primase, DNA, polypeptide 1 (49kDa) |
| Alias Symbols |
p49 |
| Peptide Sequence |
Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Arezi,B., (1999) Biochemistry 38 (39), 12899-12907 |
| Description of Target |
The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. PRIM1 is the small, 49 kDa primase subunit.The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. The protein encoded by this gene is the small, 49 kDa primase subunit. |
| Protein Interactions |
FAM96B; CIAO1; UBC; MMS19; MDC1; POLA2; PRIM2; POLE; POLA1; COPS6; RPA3; RPA2; RPA1; RAE1; MRPL38; TP53; XRCC5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PRIM1 (ARP46013_T100) antibody |
| Blocking Peptide |
For anti-PRIM1 (ARP46013_T100) antibody is Catalog # AAP46013 (Previous Catalog # AAPP26856) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PRIM1 |
| Uniprot ID |
P49642 |
| Protein Name |
DNA primase small subunit |
| Protein Accession # |
NP_000937 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000946 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PRIM1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 80%; Zebrafish: 79% |
| Image 1 | Human K562
 | WB Suggested Anti-PRIM1 Antibody Titration: 1.25ug/ml
Positive Control: K562 cell lysate |
|
