| Product Number |
ARP45902_T100 |
| Product Page |
www.avivasysbio.com/tcp10l-antibody-middle-region-arp45902-t100.html |
| Name |
TCP10L Antibody - middle region (ARP45902_T100) |
| Protein Size (# AA) |
215 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
140290 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
T-complex 10 (mouse)-like |
| Alias Symbols |
PRED77, C21orf77, TCP10A-1, TCP10A-2, LINC00846 |
| Peptide Sequence |
Synthetic peptide located within the following region: ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yu,H., (2005) Int. J. Androl. 28 (3), 163-170 |
| Description of Target |
TCP10L is a human leucine zipper protein with transcription inhibition activity. |
| Protein Interactions |
FBXO25; PMF1; MXD4; TNNC1; DAPK3; APP; Nedd4; IKBKG; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TCP10L (ARP45902_T100) antibody |
| Blocking Peptide |
For anti-TCP10L (ARP45902_T100) antibody is Catalog # AAP45902 (Previous Catalog # AAPS16501) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TCP10L |
| Uniprot ID |
Q8TDR4 |
| Protein Name |
T-complex protein 10A homolog 2 |
| Protein Accession # |
NP_653260 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_144659 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TCP10L |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-TCP10L Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Heart
 | Human Heart |
|
|
