| Product Number |
ARP45854_T100 |
| Product Page |
www.avivasysbio.com/pofut2-antibody-c-terminal-region-arp45854-t100.html |
| Name |
POFUT2 Antibody - C-terminal region (ARP45854_T100) |
| Protein Size (# AA) |
424 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
23275 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Protein O-fucosyltransferase 2 |
| Alias Symbols |
FUT13, C21orf80 |
| Peptide Sequence |
Synthetic peptide located within the following region: RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Menzel,O., (2004) Genomics 84 (2), 320-330 |
| Description of Target |
POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats. |
| Protein Interactions |
USP22; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-POFUT2 (ARP45854_T100) antibody |
| Additional Information |
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-POFUT2 (ARP45854_T100) antibody is Catalog # AAP45854 (Previous Catalog # AAPP27217) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human POFUT2 |
| Uniprot ID |
Q9Y2G5-1 |
| Protein Name |
GDP-fucose protein O-fucosyltransferase 2 |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that POFUT2 is expressed in HepG2 |
| Protein Accession # |
NP_056042 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_015227 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
POFUT2 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Stomach
 | Human Stomach |
| | Image 2 | Human HepG2
 | WB Suggested Antibody Titration: 2.5 ug/ml
Positive Control: HepG2There is BioGPS gene expression data showing that POFUT2 is expressed in HepG2 |
|
|
