| Product Number |
ARP45845_P050 |
| Product Page |
www.avivasysbio.com/n6amt1-antibody-n-terminal-region-arp45845-p050.html |
| Name |
N6AMT1 Antibody - N-terminal region (ARP45845_P050) |
| Protein Size (# AA) |
186 amino acids |
| Molecular Weight |
20kDa |
| NCBI Gene Id |
29104 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
N-6 adenine-specific DNA methyltransferase 1 (putative) |
| Alias Symbols |
KMT9, MTQ2, PrmC, HEMK2, N6AMT, PRED28, C21orf127, m.HsaHemK2P |
| Peptide Sequence |
Synthetic peptide located within the following region: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
| Protein Interactions |
SUP45; SUP35; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-N6AMT1 (ARP45845_P050) antibody |
| Blocking Peptide |
For anti-N6AMT1 (ARP45845_P050) antibody is Catalog # AAP45845 (Previous Catalog # AAPS17007) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human N6AMT1 |
| Uniprot ID |
Q96F73 |
| Protein Name |
HemK methyltransferase family member 2 |
| Sample Type Confirmation |
N6AMT1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
| Protein Accession # |
NP_877426 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_182749 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
N6AMT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-N6AMT1 Antibody Titration: 5% Milk
ELISA Titer: dilution: 1:500
Positive Control: Mouse Brain lysate |
|
| Image 2 | Human NCI-H226
 | WB Suggested Anti-N6AMT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: NCI-H226 cell lysateN6AMT1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
|
