CCT8 Antibody - C-terminal region (ARP45837_P050)

• Product Number: ARP45837_P050
• Name: CCT8 Antibody - C-terminal region (ARP45837_P050)
• Protein Size (# AA): 548 amino acids
• Molecular Weight: 59kDa
• Subunit: theta
• NCBI Gene Id: 10694
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chaperonin containing TCP1, subunit 8 (theta)
• Alias Symbols: Cctq, PRED71, D21S246, C21orf112
• Peptide Sequence: Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
• Description of Target: As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
• Protein Interactions: FUS; HUWE1; UBC; TP53; TUBG1; SUMO3; LGALS3BP; NEDD1; CDC20; SUMO1; NEDD8; MDM2; ASB13; CCT5; CCT2; CCT7; CCT6A; FBXO6; UBD; FBXW4; HDAC3; STK24; ILK; CDK9; CDK5; CDK2; PAN2; FN1; METTL21B; TP63; VCAM1; PEX14; NOS2; ITGA4; US3; FAM86B2; METTL20; METTL18;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CCT8 (ARP45837_P050) antibody is Catalog # AAP45837 (Previous Catalog # AAPP26773)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCT8
• Uniprot ID: Q5RAP1
• Protein Name: T-complex protein 1 subunit theta
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

• Sample Type Confirmation:

  CCT8 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

• Protein Accession #: NP_006576
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006585
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: CCT8
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 86%
• Image 1: Human HEK293T
  
  CCT8 antibody - C-terminal region (ARP45837_P050) validated by WB using HEK 293T at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.CCT8 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
• Image 2: Human Jurkat
  
  WB Suggested Anti-CCT8 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate.CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat
• Image 3: Human lymphoblastoid, Mouse brain
  
  CCT8 antibody - C-terminal region (ARP45837_P050) validated by WB using human lymphoblastoid & mouse brain
• Image 4: Mouse Testis
  
  Host: Mouse
  Target Name: CCT8
  Sample Tissue: Mouse Testis
  Antibody Dilution: 1ug/ml
• Image 5: Mouse Testis
  
  Host: Rabbit
  Target Name: CCT8
  Sample Tissue: Mouse Testis
  Antibody Dilution: 1ug/ml