| Product Number |
ARP45817_T100 |
| Product Page |
www.avivasysbio.com/gatd3a-antibody-n-terminal-region-arp45817-t100.html |
| Name |
GATD3A Antibody - N-terminal region (ARP45817_T100) |
| Protein Size (# AA) |
237 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
8209 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
glutamine amidotransferase like class 1 domain containing 3A |
| Alias Symbols |
ES1, HES1, KNPH, KNPI, GATD3, GT335, C21orf33 |
| Peptide Sequence |
Synthetic peptide located within the following region: SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hartman,J., (2004) Oncogene 23 (54), 8826-8833 |
| Description of Target |
This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. |
| Protein Interactions |
UBC; SUMO1; NEDD8; APP; FRA10AC1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GATD3A (ARP45817_T100) antibody |
| Additional Information |
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-GATD3A (ARP45817_T100) antibody is Catalog # AAP45817 (Previous Catalog # AAPS17004) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf33 |
| Uniprot ID |
P30042-2 |
| Protein Name |
glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial; ES1 protein homolog, mitochondrial |
| Sample Type Confirmation |
C21orf33 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_937798 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_198155 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GATD3A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Sheep, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93%; Zebrafish: 86% |
| Image 1 | Human Muscle
 | Human Muscle |
|
| Image 2 | Human HepG2
 | WB Suggested Antibody Titration: 2.5 ug/ml
Positive Control: HepG2C21orf33 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
