| Product Number |
ARP45801_T100 |
| Product Page |
www.avivasysbio.com/cbr1-antibody-c-terminal-region-arp45801-t100.html |
| Name |
CBR1 Antibody - C-terminal region (ARP45801_T100) |
| Protein Size (# AA) |
277 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
873 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Carbonyl reductase 1 |
| Alias Symbols |
CBR, hCBR1, PG-9-KR, SDR21C1 |
| Peptide Sequence |
Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cheon,M.S., (2003) Amino Acids 25 (1), 41-47 |
| Description of Target |
Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q. |
| Protein Interactions |
MDM2; GRB2; VHL; ESR1; UBC; COPS5; CUL1; UL27; RAD21; Mapk13; UBA5; DDA1; ATG101; PRKAB1; EGFR; ERCC8; MCC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CBR1 (ARP45801_T100) antibody |
| Blocking Peptide |
For anti-CBR1 (ARP45801_T100) antibody is Catalog # AAP45801 (Previous Catalog # AAPP26745) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CBR1 |
| Uniprot ID |
P16152 |
| Protein Name |
Carbonyl reductase [NADPH] 1 |
| Protein Accession # |
NP_001748 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001757 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CBR1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 92% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CBR1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
