Dyrk1a Antibody - N-terminal region (ARP45796_P050)

• Product Number: ARP45796_P050
• Name: Dyrk1a Antibody - N-terminal region (ARP45796_P050)
• Protein Size (# AA): 763 amino acids
• Molecular Weight: 85kDa
• NCBI Gene Id: 13548
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a
• Alias Symbols: Dyr, Mnb, mmb, Dyrk, Mnbh, Mp86, Gm10783, D16Ertd272, D16Ertd493, D16Ertd272e, D16Ertd493e, 2310043O08Rik
• Peptide Sequence: Synthetic peptide located within the following region: SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Dyrk1a may play a role in a signaling pathway regulating nuclear functions of cell proliferation. Dyrk1a phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.
• Protein Interactions: Rad54l2; Ywhae;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Dyrk1a (ARP45796_P050) antibody is Catalog # AAP45796 (Previous Catalog # AAPP26740)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: Q63470
• Protein Name: Dual specificity tyrosine-phosphorylation-regulated kinase 1A
• Protein Accession #: NP_031916
• Purification: Affinity Purified
• Nucleotide Accession #: NM_007890
• Tested Species Reactivity: Mouse
• Gene Symbol: Dyrk1a
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Mouse Heart
  
  WB Suggested Anti-Dyrk1a Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Mouse Heart