SOD1 Antibody - N-terminal region (ARP45752_T100)

• Product Number: ARP45752_T100
• Name: SOD1 Antibody - N-terminal region (ARP45752_T100)
• Protein Size (# AA): 154 amino acids
• Molecular Weight: 16kDa
• NCBI Gene Id: 6647
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Superoxide dismutase 1, soluble
• Alias Symbols: ALS, SOD, ALS1, IPOA, STAHP, hSod1, HEL-S-44, homodimer
• Peptide Sequence: Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hays,A.P., J. Neurol. Sci. 242 (1-2), 67-69 (2006)
• Description of Target: SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in this gene have been implicated as causes of familial amyotrophic lateral sclerosis. Rare transcript variants have been reported for this gene.
• Protein Interactions: SOD1; CRYAB; UBC; SMAD2; HDAC6; GSH1; OPTN; PRDX5; AHCYL1; TIAL1; PRDX2; SPTBN1; SOD2; PPP2CA; PPIA; PLS3; PRDX1; NME2; NME1; Hspa4l; Hspa4; Hspa2; Hspa1b; Hsph1; Dnaja1; Hspa8; Hspa5; Ccs; UBE3A; COMMD1; Stub1; SUMO4; DYNLT1; AMFR; MARCH5; RNF19A; PSMD4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Jurkat cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 15%.
• Blocking Peptide: For anti-SOD1 (ARP45752_T100) antibody is Catalog # AAP45752 (Previous Catalog # AAPP26705)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOD1
• Uniprot ID: P00441
• Protein Name: Superoxide dismutase [Cu-Zn]
• Sample Type Confirmation:

  SOD1 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_000445
• Purification: Protein A purified
• Nucleotide Accession #: NM_000454
• Tested Species Reactivity: Human
• Gene Symbol: SOD1
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human
  
  Lanes:
  Lane 1: 50ug HeLa lysate
  Lane 2: 50ug 293T lysate
  Lane 3: 50ug K562 lysate
  Lane 4: 50ug MDA-MB-231 lysate
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:1000
  Gene Name:
  SOD1
  Submitted by:
  David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences
  
• Image 2: Human kidney
  
  Human kidney
• Image 3: Human Jurkat
  
  WB Suggested Antibody Titration: 2.5 ug/ml
  Positive Control: JurkatSOD1 is supported by BioGPS gene expression data to be expressed in Jurkat