SGPP2 Antibody - C-terminal region (ARP45734_T100)

Data Sheet
 
Product Number ARP45734_T100
Product Page www.avivasysbio.com/sgpp2-antibody-c-terminal-region-arp45734-t100.html
Name SGPP2 Antibody - C-terminal region (ARP45734_T100)
Protein Size (# AA) 338 amino acids
Molecular Weight 37kDa
NCBI Gene Id 130367
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Sphingosine-1-phosphate phosphatase 2
Alias Symbols SPP2, SPPase2
Peptide Sequence Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target In vitro, SGPP2 has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P).
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SGPP2 (ARP45734_T100) antibody
Blocking Peptide For anti-SGPP2 (ARP45734_T100) antibody is Catalog # AAP45734 (Previous Catalog # AAPP11867)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SGPP2
Uniprot ID Q8IWX5
Publications

Rajkumar Vutukuri, et al. Alteration of sphingolipid metabolism as a putative mechanism underlying LPS-induced BBB disruption. 172-185 (2018). 29023711

Protein Accession # XP_001128702
Purification Protein A purified
Tested Species Reactivity Human
Gene Symbol SGPP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85%
Image 1
Human HepG2
WB Suggested Anti-SGPP2 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com