Product Number |
ARP45734_T100 |
Product Page |
www.avivasysbio.com/sgpp2-antibody-c-terminal-region-arp45734-t100.html |
Name |
SGPP2 Antibody - C-terminal region (ARP45734_T100) |
Protein Size (# AA) |
338 amino acids |
Molecular Weight |
37kDa |
NCBI Gene Id |
130367 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Sphingosine-1-phosphate phosphatase 2 |
Alias Symbols |
SPP2, SPPase2 |
Peptide Sequence |
Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
In vitro, SGPP2 has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P). |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SGPP2 (ARP45734_T100) antibody |
Blocking Peptide |
For anti-SGPP2 (ARP45734_T100) antibody is Catalog # AAP45734 (Previous Catalog # AAPP11867) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SGPP2 |
Uniprot ID |
Q8IWX5 |
Publications |
Rajkumar Vutukuri, et al. Alteration of sphingolipid metabolism as a putative mechanism underlying LPS-induced BBB disruption. 172-185 (2018). 29023711 |
Protein Accession # |
XP_001128702 |
Purification |
Protein A purified |
Tested Species Reactivity |
Human |
Gene Symbol |
SGPP2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85% |
Image 1 | Human HepG2
| WB Suggested Anti-SGPP2 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysate |
| Image 2 | Human kidney
| Human kidney |
|
|