| Product Number |
ARP45710_T100 |
| Product Page |
www.avivasysbio.com/gpt-antibody-n-terminal-region-arp45710-t100.html |
| Name |
GPT Antibody - N-terminal region (ARP45710_T100) |
| Protein Size (# AA) |
496 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
2875 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Glutamic-pyruvate transaminase (alanine aminotransferase) |
| Alias Symbols |
AAT1, ALT1, GPT1 |
| Peptide Sequence |
Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gonzalez,S.A., (2006) J. Acquir. Immune Defic. Syndr. 41 (5), 582-589 |
| Description of Target |
GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles. |
| Protein Interactions |
CAPN1; CDC7; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GPT (ARP45710_T100) antibody |
| Additional Information |
IHC Information: Fetal liver cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-GPT (ARP45710_T100) antibody is Catalog # AAP45710 (Previous Catalog # AAPP11843) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GPT |
| Uniprot ID |
P24298 |
| Protein Name |
Alanine aminotransferase 1 |
| Protein Accession # |
NP_005300 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005309 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GPT |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human Muscle
 | Human Muscle |
| | Image 2 | Human Fetal liver
 | WB Suggested Anti-GPT Antibody Titration: 5.0ug/ml
Positive Control: Fetal liver cell lysate |
|
|
