ECHS1 antibody - middle region (ARP45699_T100)
Data Sheet
Product Number ARP45699_T100
Product Page
Product Name ECHS1 antibody - middle region (ARP45699_T100)
Size 100 ul
Gene Symbol ECHS1
Alias Symbols SCEH
Protein Size (# AA) 290 amino acids
Molecular Weight 28kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1892
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Enoyl CoA hydratase, short chain, 1, mitochondrial
Description This is a rabbit polyclonal antibody against ECHS1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA
Target Reference Bruneel,A., (2005) Proteomics 5 (15), 3876-3884
Description of Target ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ECHS1 (ARP45699_T100) antibody is Catalog # AAP45699 (Previous Catalog # AAPP26694)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ECHS1
Complete computational species homology data Anti-ECHS1 (ARP45699_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ECHS1.
Swissprot Id P30084
Protein Name Enoyl-CoA hydratase, mitochondrial
Protein Accession # NP_004083
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ECHS1.
Nucleotide Accession # NM_004092
Replacement Item This antibody may replace item sc-133534 from Santa Cruz Biotechnology.
Conjugation Options

ARP45699_T100-FITC Conjugated

ARP45699_T100-HRP Conjugated

ARP45699_T100-Biotin Conjugated

CB Replacement sc-133534; sc-164255
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Image 1
Human Liver
WB Suggested Anti-ECHS1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |