Product Number |
ARP45696_T100 |
Product Page |
www.avivasysbio.com/aldh4a1-antibody-n-terminal-region-arp45696-t100.html |
Name |
ALDH4A1 Antibody - N-terminal region (ARP45696_T100) |
Protein Size (# AA) |
214 amino acids |
Molecular Weight |
24kDa |
NCBI Gene Id |
8659 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Aldehyde dehydrogenase 4 family, member A1 |
Alias Symbols |
P5CD, ALDH4, P5CDh |
Peptide Sequence |
Synthetic peptide located within the following region: QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline. |
Protein Interactions |
UBC; MDM2; ALDH4A1; ARG1; APP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ALDH4A1 (ARP45696_T100) antibody |
Blocking Peptide |
For anti-ALDH4A1 (ARP45696_T100) antibody is Catalog # AAP45696 (Previous Catalog # AAPP11829) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ALDH4A1 |
Uniprot ID |
Q5TF55 |
Protein Name |
Aldehyde dehydrogenase 4 family, member A1 EMBL CAI23418.1 |
Sample Type Confirmation |
ALDH4A1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
CAI23418 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001161504 |
Tested Species Reactivity |
Human |
Gene Symbol |
ALDH4A1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 92% |
Image 1 | Human HepG2
| WB Suggested Anti-ALDH4A1 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysateALDH4A1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|
Image 2 | Human Intestine
| Human Intestine |
|