CPS1 Antibody - middle region (ARP45690_T100)

Data Sheet
 
Product Number ARP45690_T100
Product Page www.avivasysbio.com/cps1-antibody-middle-region-arp45690-t100.html
Name CPS1 Antibody - middle region (ARP45690_T100)
Protein Size (# AA) 1500 amino acids
Molecular Weight 165kDa
NCBI Gene Id 1373
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Carbamoyl-phosphate synthase 1, mitochondrial
Alias Symbols PHN, CPSASE1
Peptide Sequence Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Huo,R., (2005) J. Biochem. Mol. Biol. 38 (1), 28-33
Description of Target Carbamoyl phosphate synthetase I is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis.Carbamoyl phosphate synthetase I (EC 6.3.4.16) is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis (CAD; MIM 114010), which has been mapped to 2p21.[supplied by OMIM].
Protein Interactions AGO2; ASB1; FBXO6; UBC; MRPS26; LRPPRC; TOMM70A; SEC22B; PCBP1; HSPA9; HSPA1A; FH; CPT1A; MYC; ELAVL1; SUMO2; RAD21; Csnk1e; Cdk1; RICTOR; YWHAQ; H2AFX; ARAF; RAF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CPS1 (ARP45690_T100) antibody
Additional Information IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 8%.
Blocking Peptide For anti-CPS1 (ARP45690_T100) antibody is Catalog # AAP45690 (Previous Catalog # AAPP11823)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CPS1
Uniprot ID P31327
Protein Name Carbamoyl-phosphate synthase [ammonia], mitochondrial
Protein Accession # NP_001866
Purification Protein A purified
Nucleotide Accession # NM_001875
Tested Species Reactivity Human, Pig
Gene Symbol CPS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%; Yeast: 77%
Image 1
Human Fetal liver
WB Suggested Anti-CPS1 Antibody Titration: 5.0ug/ml
Positive Control: Fetal liver cell lysate
Image 2
Human Intestine
Human Intestine
Image 3
Pig duodenum
Sample Type:
Pig duodenum
Primary Antibody Dilution:
1:500
Secondary Antibody:
Anti-rabbit-biotin, streptavidin-HRP
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
Brown: CPS
Gene Name:
CPS1
Submitted by:
Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine
Image 4
Pig ileum
Sample Type:
Pig ileum
Primary Antibody Dilution:
1:500
Secondary Antibody:
Anti-rabbit-biotin, streptavidin-HRP
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
Brown: CPS
Gene Name:
CPS1
Submitted by:
Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine
Image 5
Pig kidney
Sample Type:
Pig kidney
Primary Antibody Dilution:
1:500
Secondary Antibody:
Anti-rabbit-biotin, streptavidin-HRP
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
Brown: CPS
Gene Name:
CPS1
Submitted by:
Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com