ARG1 Antibody - N-terminal region (ARP45672_T100)

Data Sheet
 
Product Number ARP45672_T100
Product Page www.avivasysbio.com/arg1-antibody-n-terminal-region-arp45672-t100.html
Name ARG1 Antibody - N-terminal region (ARP45672_T100)
Protein Size (# AA) 322 amino acids
Molecular Weight 35kDa
NCBI Gene Id 383
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Arginase, liver
Peptide Sequence Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Orellana,M.S., (2002) Arch. Biochem. Biophys. 403 (2), 155-159
Description of Target Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.
Protein Interactions RPA3; RPA2; RPA1; SUZ12; EZH2; BMI1; ALDH4A1; ESR1; RAD21; UBC; UCHL5; ATG101; USP53; FLOT1; NOS1; ARG2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ARG1 (ARP45672_T100) antibody
Additional Information IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%.
Blocking Peptide For anti-ARG1 (ARP45672_T100) antibody is Catalog # AAP45672 (Previous Catalog # AAPP25826)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ARG1
Uniprot ID P05089
Protein Name Arginase-1
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

Protein Accession # NP_000036
Purification Protein A purified
Nucleotide Accession # NM_000045
Tested Species Reactivity Human
Gene Symbol ARG1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-ARG1 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Lung
Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com