Product Number |
ARP45495_T100 |
Product Page |
www.avivasysbio.com/chst1-antibody-n-terminal-region-arp45495-t100.html |
Name |
CHST1 Antibody - N-terminal region (ARP45495_T100) |
Protein Size (# AA) |
411 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
8534 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 |
Description |
|
Alias Symbols |
C6ST, KSST, GST-1, KS6ST, KSGal6ST |
Peptide Sequence |
Synthetic peptide located within the following region: SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yamada,T., Biochem. J. 384 (PT 3), 567-575 (2004) |
Description of Target |
CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. It may function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. It participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. |
Protein Interactions |
NHP2L1; SFN; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHST1 (ARP45495_T100) antibody |
Additional Information |
IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%. |
Blocking Peptide |
For anti-CHST1 (ARP45495_T100) antibody is Catalog # AAP45495 (Previous Catalog # AAPP26560) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHST1 |
Uniprot ID |
O43916 |
Protein Name |
Carbohydrate sulfotransferase 1 |
Publications |
Sulfation of O-glycans on Mucin-type Proteins From Serous Ovarian Epithelial Tumors. Mol Cell Proteomics. 20, 100150 (2021). 34555499 |
Protein Accession # |
NP_003645 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003654 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHST1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Muscle
| Human Muscle |
|
Image 2 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|