ZP2 Antibody - C-terminal region (ARP45470_T100)

Data Sheet
 
Product Number ARP45470_T100
Product Page www.avivasysbio.com/zp2-antibody-c-terminal-region-arp45470-t100.html
Name ZP2 Antibody - C-terminal region (ARP45470_T100)
Protein Size (# AA) 745 amino acids
Molecular Weight 68kDa
NCBI Gene Id 7783
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zona pellucida glycoprotein 2 (sperm receptor)
Alias Symbols ZPA, Zp-2, OOMD6
Peptide Sequence Synthetic peptide located within the following region: PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Furlong,L.I., (2005) Fertil. Steril. 83 (6), 1780-1790
Description of Target The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. ZP2 is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies.The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies.
Protein Interactions ZPBP; ACR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZP2 (ARP45470_T100) antibody
Blocking Peptide For anti-ZP2 (ARP45470_T100) antibody is Catalog # AAP45470 (Previous Catalog # AAPP26535)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZP2
Uniprot ID Q05996
Protein Name Zona pellucida sperm-binding protein 2
Protein Accession # NP_003451
Purification Protein A purified
Nucleotide Accession # NM_003460
Tested Species Reactivity Human
Gene Symbol ZP2
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rabbit: 93%; Rat: 86%
Image 1
Human HepG2
WB Suggested Anti-ZP2 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com