Product Number |
ARP45470_T100 |
Product Page |
www.avivasysbio.com/zp2-antibody-c-terminal-region-arp45470-t100.html |
Name |
ZP2 Antibody - C-terminal region (ARP45470_T100) |
Protein Size (# AA) |
745 amino acids |
Molecular Weight |
68kDa |
NCBI Gene Id |
7783 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zona pellucida glycoprotein 2 (sperm receptor) |
Alias Symbols |
ZPA, Zp-2, OOMD6 |
Peptide Sequence |
Synthetic peptide located within the following region: PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Furlong,L.I., (2005) Fertil. Steril. 83 (6), 1780-1790 |
Description of Target |
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. ZP2 is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies.The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. |
Protein Interactions |
ZPBP; ACR; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZP2 (ARP45470_T100) antibody |
Blocking Peptide |
For anti-ZP2 (ARP45470_T100) antibody is Catalog # AAP45470 (Previous Catalog # AAPP26535) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZP2 |
Uniprot ID |
Q05996 |
Protein Name |
Zona pellucida sperm-binding protein 2 |
Protein Accession # |
NP_003451 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003460 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZP2 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rabbit: 93%; Rat: 86% |
Image 1 | Human HepG2
| WB Suggested Anti-ZP2 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysate |
|
|