TAPBP Antibody - C-terminal region (ARP45437_P050)

• Product Number: ARP45437_P050
• Name: TAPBP Antibody - C-terminal region (ARP45437_P050)
• Protein Size (# AA): 448 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 6892
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: TAP binding protein (tapasin)
• Alias Symbols: TPN, TAPA, TPSN, NGS17
• Peptide Sequence: Synthetic peptide located within the following region: GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Facoetti,A., (2005) Clin. Cancer Res. 11 (23), 8304-8311
• Description of Target: TAPBP is a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum.This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms.
• Protein Interactions: UBC; PDIA3; Tap2; ELAVL1; US3; TAP1; B2M; COPG1; COPG2; COPB1; HLA-C; HLA-A; CALR;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Additional Information: IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%.
• Blocking Peptide: For anti-TAPBP (ARP45437_P050) antibody is Catalog # AAP45437 (Previous Catalog # AAPP26506)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TAPBP
• Uniprot ID: O15533
• Protein Name: Tapasin
• Protein Accession #: NP_003181
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003190
• Tested Species Reactivity: Human
• Gene Symbol: TAPBP
• Predicted Species Reactivity: Human, Cow, Pig, Sheep
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Human: 100%; Pig: 86%; Sheep: 86%
• Image 1: Human HepG2
  
  WB Suggested Anti-TAPBP Antibody Titration: 0.5ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human liver
  
  WB Suggested Anti-TAPBP antibody Titration: 1 ug/mL
  Sample Type: Human liver
• Image 3: liver
  
  Rabbit Anti-TAPBP Antibody
  Catalog Number: ARP45437_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult liver
  Observed Staining: Cytoplasmic
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy2/3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.
• Image 4: Human Skin
  
  Human Skin
• Image 5:
  
  ARP45437-QC15524-41600-WB-image.jpg