Product Number |
ARP45419_P050 |
Product Page |
www.avivasysbio.com/soat1-antibody-middle-region-arp45419-p050.html |
Name |
SOAT1 Antibody - middle region (ARP45419_P050) |
Protein Size (# AA) |
550 amino acids |
Molecular Weight |
65kDa |
NCBI Gene Id |
6646 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Sterol O-acyltransferase 1 |
Alias Symbols |
ACAT, SOAT, STAT, ACACT, ACAT1, ACAT-1 |
Peptide Sequence |
Synthetic peptide located within the following region: ASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Acyl-coenzyme A:cholesterol acyltransferase (ACACT; EC 2.3.1.26) is an intracellular protein located in the endoplasmic reticulum that forms cholesterol esters from cholesterol. Accumulation of cholesterol esters as cytoplasmic lipid droplets within macrophages and smooth muscle cells is a characteristic feature of the early stages of atherosclerotic plaques (Cadigan et al., 1988 [PubMed 3335499]). |
Protein Interactions |
UBC; ILF2; SLC25A10; TERF1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SOAT1 (ARP45419_P050) antibody |
Blocking Peptide |
For anti-SOAT1 (ARP45419_P050) antibody is Catalog # AAP45419 (Previous Catalog # AAPP26386) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SOAT1 |
Uniprot ID |
P35610 |
Protein Name |
Sterol O-acyltransferase 1 |
Protein Accession # |
NP_003092 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003101 |
Tested Species Reactivity |
Human |
Gene Symbol |
SOAT1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86% |
Image 1 | Human HeLa
| WB Suggested Anti-SOAT1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Hela cell lysate |
|