SOAT1 Antibody - middle region (ARP45419_P050)

Data Sheet
 
Product Number ARP45419_P050
Product Page www.avivasysbio.com/soat1-antibody-middle-region-arp45419-p050.html
Name SOAT1 Antibody - middle region (ARP45419_P050)
Protein Size (# AA) 550 amino acids
Molecular Weight 65kDa
NCBI Gene Id 6646
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sterol O-acyltransferase 1
Alias Symbols ACAT, SOAT, STAT, ACACT, ACAT1, ACAT-1
Peptide Sequence Synthetic peptide located within the following region: ASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Acyl-coenzyme A:cholesterol acyltransferase (ACACT; EC 2.3.1.26) is an intracellular protein located in the endoplasmic reticulum that forms cholesterol esters from cholesterol. Accumulation of cholesterol esters as cytoplasmic lipid droplets within macrophages and smooth muscle cells is a characteristic feature of the early stages of atherosclerotic plaques (Cadigan et al., 1988 [PubMed 3335499]).
Protein Interactions UBC; ILF2; SLC25A10; TERF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SOAT1 (ARP45419_P050) antibody
Blocking Peptide For anti-SOAT1 (ARP45419_P050) antibody is Catalog # AAP45419 (Previous Catalog # AAPP26386)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SOAT1
Uniprot ID P35610
Protein Name Sterol O-acyltransferase 1
Protein Accession # NP_003092
Purification Affinity Purified
Nucleotide Accession # NM_003101
Tested Species Reactivity Human
Gene Symbol SOAT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%
Image 1
Human HeLa
WB Suggested Anti-SOAT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com