Product Number |
ARP45387_P050 |
Product Page |
www.avivasysbio.com/ptprr-antibody-c-terminal-region-arp45387-p050.html |
Name |
PTPRR Antibody - C-terminal region (ARP45387_P050) |
Protein Size (# AA) |
412 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
5801 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Protein tyrosine phosphatase, receptor type, R |
Alias Symbols |
PTPRQ, EC-PTP, PCPTP1, PTP-SL, PTPBR7 |
Peptide Sequence |
Synthetic peptide located within the following region: NYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Eswaran,J., (2006) Biochem. J. 395 (3), 483-491 |
Description of Target |
PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP.The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP. The similar gene predominately expressed in mouse brain was found to associate with, and thus regulate the activity and cellular localization of MAP kinases. The rat counterpart of this gene was reported to be regulated by the nerve growth factor, which suggested the function of this gene in neuronal growth and differentiation. Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, and an RNA component, encoded by this gene, that serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Mutations in this gene cause autosomal dominant dyskeratosis congenita, and may also be associated with some cases of aplastic anemia. |
Protein Interactions |
MAPK3; MAPK1; MAPK7; PRKACA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PTPRR (ARP45387_P050) antibody |
Blocking Peptide |
For anti-PTPRR (ARP45387_P050) antibody is Catalog # AAP45387 (Previous Catalog # AAPP26358) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PTPRR |
Uniprot ID |
Q7Z2V8 |
Protein Name |
Putative uncharacterized protein DKFZp686K0257 EMBL CAE11876.1 |
Protein Accession # |
NP_570897 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_130846 |
Tested Species Reactivity |
Human |
Gene Symbol |
PTPRR |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-PTPRR Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|