| Product Number |
ARP45277_P050 |
| Product Page |
www.avivasysbio.com/lsamp-antibody-n-terminal-region-arp45277-p050.html |
| Name |
LSAMP Antibody - N-terminal region (ARP45277_P050) |
| Protein Size (# AA) |
338 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
4045 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Limbic system-associated membrane protein |
| Alias Symbols |
LAMP, IGLON3 |
| Peptide Sequence |
Synthetic peptide located within the following region: MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Pimenta,A.F., (1998) Genomics 49 (3), 472-474 |
| Description of Target |
LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections. |
| Protein Interactions |
LSAMP; NEGR1; NTM; Htt; PRNP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LSAMP (ARP45277_P050) antibody |
| Blocking Peptide |
For anti-LSAMP (ARP45277_P050) antibody is Catalog # AAP45277 (Previous Catalog # AAPP26259) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LSAMP |
| Uniprot ID |
Q13449 |
| Protein Name |
Limbic system-associated membrane protein |
| Protein Accession # |
NP_002329 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002338 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LSAMP |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-LSAMP Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
