GZMK Antibody - N-terminal region (ARP45219_P050)

• Product Number: ARP45219_P050
• Name: GZMK Antibody - N-terminal region (ARP45219_P050)
• Protein Size (# AA): 264 amino acids
• Molecular Weight: 26kDa
• NCBI Gene Id: 3003
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Granzyme K (granzyme 3; tryptase II)
• Alias Symbols: TRYP2
• Peptide Sequence: Synthetic peptide located within the following region: PTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fajardo,I. Biochem. J. 369 (PT 3), 603-610 (2003)
• Description of Target: GZMK is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes.This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes.
• Protein Interactions: SET; HMGB2; APEX1; PNKP; LIG4; HNRNPK; GOLGA2; ACTG1; TUBB3; NPLOC4; VCP; UFD1L;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GZMK (ARP45219_P050) antibody is Catalog # AAP45219 (Previous Catalog # AAPP26210)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GZMK
• Uniprot ID: P49863
• Protein Name: Granzyme K
• Protein Accession #: NP_002095
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002104
• Tested Species Reactivity: Human
• Gene Symbol: GZMK
• Predicted Species Reactivity: Human, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Horse: 79%; Human: 100%; Pig: 86%
• Image 1: Human HepG2
  
  WB Suggested Anti-GZMK Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate