| Product Number |
ARP45216_P050 |
| Product Page |
www.avivasysbio.com/gns-antibody-c-terminal-region-arp45216-p050.html |
| Name |
Gns Antibody - C-terminal region (ARP45216_P050) |
| Protein Size (# AA) |
519 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
299825 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Glucosamine (N-acetyl)-6-sulfatase |
| Alias Symbols |
Gns |
| Peptide Sequence |
Synthetic peptide located within the following region: YIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Gns (ARP45216_P050) antibody |
| Blocking Peptide |
For anti-Gns (ARP45216_P050) antibody is Catalog # AAP45216 (Previous Catalog # AAPP26207) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
Q5M918 |
| Protein Name |
Glucosamine (N-acetyl)-6-sulfatase EMBL AAH87741.1 |
| Protein Accession # |
NP_001011989 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001011989 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Gns |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Rat Heart
 | WB Suggested Anti-Gns Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Heart |
|
|
