Dct Antibody - middle region (ARP45193_P050)

• Product Number: ARP45193_P050
• Name: Dct Antibody - middle region (ARP45193_P050)
• Protein Size (# AA): 517 amino acids
• Molecular Weight: 59 kDa
• NCBI Gene Id: 13190
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Dopachrome tautomerase
• Alias Symbols: DT, TR, TRP, Tyr, slt, TRP2, Tyrp, TRP-2, Tyrp2, slaty, Tyrp-2
• Peptide Sequence: Synthetic peptide located within the following region: QHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of Dct remains unknown.
• Protein Interactions: Tle4; Pax3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-Dct (ARP45193_P050) antibody is Catalog # AAP45193 (Previous Catalog # AAPP26182)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: Q6NXI2
• Protein Name: L-dopachrome tautomerase
• Protein Accession #: NP_034154
• Purification: Affinity Purified
• Nucleotide Accession #: NM_010024
• Tested Species Reactivity: Mouse, Zebrafish
• Gene Symbol: Dct
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Image 1: Zebrafish embryo
  
  Sample Type:
  Zebrafish embryo section
  Primary Antibody Dilution:
  1:50
  Secondary Antibody:
  Anti-rabbit-Alexa Fluor 488
  Secondary Antibody Dilution:
  1:500
  Color/Signal Descriptions:
  Green: DCT
  Gene Name:
  Dct
  Submitted by:
  Anonymous
• Image 2: Mouse Heart
  
  WB Suggested Anti-Dct Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Mouse Heart
• Image 3: Mouse Skeletal Muscle
  
  Host: Mouse
  Target Name: DCT
  Sample Tissue: Mouse Skeletal Muscle
  Antibody Dilution: 1ug/ml
• Image 4:
  
  25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.