IL10RA Antibody - N-terminal region (ARP45135_T100)

• Product Number: ARP45135_T100
• Name: IL10RA Antibody - N-terminal region (ARP45135_T100)
• Protein Size (# AA): 578 amino acids
• Molecular Weight: 61kDa
• Subunit: alpha
• NCBI Gene Id: 3587
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Interleukin 10 receptor, alpha
• Alias Symbols: CD210, IL10R, CD210a, CDW210A, HIL-10R, IL-10R1
• Peptide Sequence: Synthetic peptide located within the following region: GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gasche,C., (2003) J. Immunol. 170 (11), 5578-5582
• Description of Target: IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.
• Protein Interactions: BTRC; UBC; IL10RB; JAK1; IL10;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-IL10RA (ARP45135_T100) antibody is Catalog # AAP45135 (Previous Catalog # AAPP26126)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL10RA
• Uniprot ID: Q13651
• Protein Name: Interleukin-10 receptor subunit alpha
• Protein Accession #: NP_001549
• Purification: Protein A purified
• Nucleotide Accession #: NM_001558
• Tested Species Reactivity: Human
• Gene Symbol: IL10RA
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Guinea Pig: 92%; Horse: 85%; Human: 100%;
• Image 1: Human Jurkat
  
  WB Suggested Anti-IL10RA Antibody Titration: 5.0ug/ml
  Positive Control: Jurkat cell lysate