| Product Number |
ARP45055_P050 |
| Product Page |
www.avivasysbio.com/aoc2-antibody-middle-region-arp45055-p050.html |
| Name |
AOC2 Antibody - middle region (ARP45055_P050) |
| Protein Size (# AA) |
756 amino acids |
| Molecular Weight |
84kDa |
| NCBI Gene Id |
314 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Amine oxidase, copper containing 2 (retina-specific) |
| Alias Symbols |
RAO, DAO2, SSAO |
| Peptide Sequence |
Synthetic peptide located within the following region: QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716 |
| Description of Target |
Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine.Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. This gene shows high sequence similarity to copper amine oxidases from various species ranging from bacteria to mammals. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine. This gene may be a candidate gene for hereditary ocular diseases. Alternate splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AOC2 (ARP45055_P050) antibody |
| Blocking Peptide |
For anti-AOC2 (ARP45055_P050) antibody is Catalog # AAP45055 (Previous Catalog # AAPP12343) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human AOC2 |
| Uniprot ID |
O75106 |
| Protein Name |
Retina-specific copper amine oxidase |
| Protein Accession # |
NP_033720 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009590 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AOC2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 83% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-AOC2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
