| Product Number |
ARP45005_T100 |
| Product Page |
www.avivasysbio.com/flj22167-antibody-n-terminal-region-arp45005-t100.html |
| Name |
FLJ22167 Antibody - N-terminal region (ARP45005_T100) |
| Protein Size (# AA) |
316 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
79583 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transmembrane protein 231 |
| Alias Symbols |
MKS11, JBTS20, ALYE870, PRO1886 |
| Peptide Sequence |
Synthetic peptide located within the following region: CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
NOTCH2NL; KRT40; UBC; KRT31; FBXO6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TMEM231 (ARP45005_T100) antibody |
| Blocking Peptide |
For anti-TMEM231 (ARP45005_T100) antibody is Catalog # AAP45005 (Previous Catalog # AAPP26082) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ22167 |
| Uniprot ID |
Q9H6L2 |
| Protein Name |
Transmembrane protein 231 |
| Protein Accession # |
NP_001070886 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001077418 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TMEM231 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-FLJ22167 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
