Pnkd Antibody - N-terminal region (ARP44997_P050)

Data Sheet
 
Product Number ARP44997_P050
Product Page www.avivasysbio.com/pnkd-antibody-n-terminal-region-arp44997-p050.html
Name Pnkd Antibody - N-terminal region (ARP44997_P050)
Protein Size (# AA) 142 amino acids
Molecular Weight 15kDa
NCBI Gene Id 56695
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Paroxysmal nonkinesiogenic dyskinesia
Alias Symbols Brp, MR-1, Brp17, Tahccp2, AI854243, MNCb-5687, 2210013N15Rik, 2810403H05Rik
Peptide Sequence Synthetic peptide located within the following region: MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Pnkd is a probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B signaling pathway.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Pnkd (ARP44997_P050) antibody
Blocking Peptide For anti-Pnkd (ARP44997_P050) antibody is Catalog # AAP44997 (Previous Catalog # AAPP26075)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q69ZP3-2
Protein Name Probable hydrolase PNKD
Protein Accession # NP_079856
Purification Affinity Purified
Nucleotide Accession # NM_025580
Tested Species Reactivity Mouse
Gene Symbol Pnkd
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Image 1
Mouse Heart
WB Suggested Anti-Pnkd Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com