Product Number |
ARP44997_P050 |
Product Page |
www.avivasysbio.com/pnkd-antibody-n-terminal-region-arp44997-p050.html |
Name |
Pnkd Antibody - N-terminal region (ARP44997_P050) |
Protein Size (# AA) |
142 amino acids |
Molecular Weight |
15kDa |
NCBI Gene Id |
56695 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Paroxysmal nonkinesiogenic dyskinesia |
Alias Symbols |
Brp, MR-1, Brp17, Tahccp2, AI854243, MNCb-5687, 2210013N15Rik, 2810403H05Rik |
Peptide Sequence |
Synthetic peptide located within the following region: MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Pnkd is a probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B signaling pathway. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Pnkd (ARP44997_P050) antibody |
Blocking Peptide |
For anti-Pnkd (ARP44997_P050) antibody is Catalog # AAP44997 (Previous Catalog # AAPP26075) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q69ZP3-2 |
Protein Name |
Probable hydrolase PNKD |
Protein Accession # |
NP_079856 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025580 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Pnkd |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93% |
Image 1 | Mouse Heart
| WB Suggested Anti-Pnkd Antibody Titration: 1.0 ug/ml Positive Control: Mouse Heart |
|
|