Product Number |
ARP44994_P050 |
Product Page |
www.avivasysbio.com/pomt1-antibody-middle-region-arp44994-p050.html |
Name |
POMT1 Antibody - middle region (ARP44994_P050) |
Protein Size (# AA) |
725 amino acids |
Molecular Weight |
82kDa |
NCBI Gene Id |
10585 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Protein-O-mannosyltransferase 1 |
Alias Symbols |
RT, LGMD2K, MDDGA1, MDDGB1, MDDGC1, LGMDR11 |
Peptide Sequence |
Synthetic peptide located within the following region: LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Messina,S., (er) Neuromuscul. Disord. (2008) In press |
Description of Target |
POMT1 is an O-mannosyltransferase that requires interaction with the product of the POMT2 gene for enzymatic function. The encoded protein is found in the membrane of the endoplasmic reticulum. Defects in this gene are a cause of Walker-Warburg syndrome (WWS) and limb-girdle muscular dystrophy type 2K (LGMD2K).O-mannosylation is an important protein modification in eukaryotes that is initiated by an evolutionarily conserved family of protein O-mannosyltransferases. POMT1 shares sequence similarity with protein O-mannosyltransferases of S. cerevisiae. In yeast, these enzymes are located in the endoplasmic reticulum (ER) and are required for cell integrity and cell wall rigidity. POMT1 also shows similarity to the Drosophila 'rotated abdomen' (rt) gene, which when mutated causes defects in myogenesis and muscle structure.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-42 DB154785.1 1-42 43-2420 AK074874.1 1-2378 2421-2617 BF984005.1 438-634 2618-3080 AL358781.19 127610-128072 |
Protein Interactions |
UBC; POMT2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-POMT1 (ARP44994_P050) antibody |
Blocking Peptide |
For anti-POMT1 (ARP44994_P050) antibody is Catalog # AAP44994 (Previous Catalog # AAPP12306) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human POMT1 |
Uniprot ID |
B3KQG0 |
Protein Name |
Protein O-mannosyl-transferase 1 |
Protein Accession # |
NP_001070833 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001077365 |
Tested Species Reactivity |
Human |
Gene Symbol |
POMT1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 77%; Rat: 86% |
Image 1 | Human HepG2
| WB Suggested Anti-POMT1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|