POMT1 Antibody - middle region (ARP44994_P050)

Data Sheet
 
Product Number ARP44994_P050
Product Page www.avivasysbio.com/pomt1-antibody-middle-region-arp44994-p050.html
Name POMT1 Antibody - middle region (ARP44994_P050)
Protein Size (# AA) 725 amino acids
Molecular Weight 82kDa
NCBI Gene Id 10585
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Protein-O-mannosyltransferase 1
Alias Symbols RT, LGMD2K, MDDGA1, MDDGB1, MDDGC1, LGMDR11
Peptide Sequence Synthetic peptide located within the following region: LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Messina,S., (er) Neuromuscul. Disord. (2008) In press
Description of Target POMT1 is an O-mannosyltransferase that requires interaction with the product of the POMT2 gene for enzymatic function. The encoded protein is found in the membrane of the endoplasmic reticulum. Defects in this gene are a cause of Walker-Warburg syndrome (WWS) and limb-girdle muscular dystrophy type 2K (LGMD2K).O-mannosylation is an important protein modification in eukaryotes that is initiated by an evolutionarily conserved family of protein O-mannosyltransferases. POMT1 shares sequence similarity with protein O-mannosyltransferases of S. cerevisiae. In yeast, these enzymes are located in the endoplasmic reticulum (ER) and are required for cell integrity and cell wall rigidity. POMT1 also shows similarity to the Drosophila 'rotated abdomen' (rt) gene, which when mutated causes defects in myogenesis and muscle structure.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-42 DB154785.1 1-42 43-2420 AK074874.1 1-2378 2421-2617 BF984005.1 438-634 2618-3080 AL358781.19 127610-128072
Protein Interactions UBC; POMT2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-POMT1 (ARP44994_P050) antibody
Blocking Peptide For anti-POMT1 (ARP44994_P050) antibody is Catalog # AAP44994 (Previous Catalog # AAPP12306)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human POMT1
Uniprot ID B3KQG0
Protein Name Protein O-mannosyl-transferase 1
Protein Accession # NP_001070833
Purification Affinity Purified
Nucleotide Accession # NM_001077365
Tested Species Reactivity Human
Gene Symbol POMT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 77%; Rat: 86%
Image 1
Human HepG2
WB Suggested Anti-POMT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com