| Product Number |
ARP44989_P050 |
| Product Page |
www.avivasysbio.com/sppl2b-antibody-n-terminal-region-arp44989-p050.html |
| Name |
SPPL2B Antibody - N-terminal region (ARP44989_P050) |
| Protein Size (# AA) |
511 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
56928 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Signal peptide peptidase like 2B |
| Alias Symbols |
IMP4, PSH4, PSL1, IMP-4 |
| Peptide Sequence |
Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SPPL2B (ARP44989_P050) antibody |
| Additional Information |
IHC Information: Jurkat cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 8%. |
| Blocking Peptide |
For anti-SPPL2B (ARP44989_P050) antibody is Catalog # AAP44989 (Previous Catalog # AAPP26068) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SPPL2B |
| Uniprot ID |
Q8TCT7-4 |
| Protein Name |
Signal peptide peptidase-like 2B |
| Publications |
Del Campo, M. et al. BRI2-BRICHOS is increased in human amyloid plaques in early stages of Alzheimerâs disease. Neurobiol. Aging 35, 1596-604 (2014). 24524963 |
| Sample Type Confirmation |
SPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_001070706 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001077238 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SPPL2B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SPPL2B Antibody Titration: 1 ug/ml
Positive Control: Jurkat cell lysateSPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat |
|
| Image 2 | Human kidney
 | Human kidney |
|
