Product Number |
ARP44959_P050 |
Product Page |
www.avivasysbio.com/c19orf28-antibody-middle-region-arp44959-p050.html |
Name |
C19orf28 Antibody - middle region (ARP44959_P050) |
Protein Size (# AA) |
473 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
126321 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Major facilitator superfamily domain containing 12 |
Alias Symbols |
PP3501, C19orf28 |
Peptide Sequence |
Synthetic peptide located within the following region: VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function remains known. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MFSD12 (ARP44959_P050) antibody |
Blocking Peptide |
For anti-MFSD12 (ARP44959_P050) antibody is Catalog # AAP44959 (Previous Catalog # AAPP26040) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C19orf28 |
Uniprot ID |
Q6NUT3 |
Protein Name |
Major facilitator superfamily domain-containing protein 12 |
Protein Accession # |
NP_001036145 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001042680 |
Tested Species Reactivity |
Human |
Gene Symbol |
MFSD12 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human HepG2
| WB Suggested Anti-C19orf28 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|
|